PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10010616
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 425aa    MW: 46715.2 Da    PI: 6.7577
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10010616genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.32.2e-10292350563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  kr +r   NR++A rs +RK  +i+eLe kv++L+ae ++L  ++  l+  +a+l+s++
  Lus10010616 292 KRVKRILANRLSAARSKERKMRYIAELELKVQALQAEATTLSAQVTVLQRDSANLTSQN 350
                  899*****************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.4E-17288352IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.841290353IPR004827Basic-leucine zipper domain
PfamPF001704.4E-9292350IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.4E-10292349No hitNo description
SuperFamilySSF579591.48E-10292348No hitNo description
CDDcd147032.94E-21293344No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MCATMRQSSP NLDPRESNKR IGLPPSYPNN SHFFADQQHR QGGTSHLRSL SQSSIFSIDF  60
RPMEQDNAAS SQGILAPVSS RVNDGGLPPL RAAAHRRAIS DTVPLGFCDM IQSSPQLVPI  120
RGQVGGFNQL ELVKQESEVS ATDEMLMMSA YMHMDNVDPL NSSGTEDNKD LDSRASSTKT  180
NGTESSDNEA ESHVKGIMRS ADGEIGPAGR HCRSVSMDSF MGGLRLDEES MIMKLPPMGV  240
RVGQQHSPSS SSMQGNLSKF NLEFGNGEFT ETELKKITSN DKLTELAMAD PKRVKRILAN  300
RLSAARSKER KMRYIAELEL KVQALQAEAT TLSAQVTVLQ RDSANLTSQN NELKFRLQSI  360
EQQAQLKDAL NEALVAEVQR LGLAASTHHH HQQQQLPVNH PMMQPGQANT YQQQQELNQA  420
HNSN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002510493.11e-141PREDICTED: transcription factor RF2a
TrEMBLB9R8501e-141B9R850_RICCO; DNA binding protein, putative
STRINGVIT_03s0038g00860.t011e-113(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.39e-85bZIP family protein